PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008244816.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family B3
Protein Properties Length: 216aa    MW: 24480.6 Da    PI: 5.9014
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008244816.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.82.9e-16108187688
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     +++ +  +g l lp +fa++h ++k++ + ++l+ ++gr+W v+++y+ +     +++ W  F+++n+Lk+gD++vF l++ +
  XP_008244816.1 108 IQPVYIHRGYLHLPSEFARRH-LVKRRARNIILKILDGRTWLVEFKYETSV--ARFQRAWLAFARDNNLKVGDVCVFVLIDCN 187
                     5666677899***********.56778889***************555555..569**********************98633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.8E-2196194IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-2197195IPR015300DNA-binding pseudobarrel domain
CDDcd100171.34E-19102190No hitNo description
PROSITE profilePS5086313.535103199IPR003340B3 DNA binding domain
SMARTSM010191.4E-11104197IPR003340B3 DNA binding domain
PfamPF023623.1E-14106188IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MVGFGLTTVG SSSQSCALLT MPEMEETDSD SEEDDDDDES GHARGEIKRE NDMPTKKDFG  60
GSSSTRIFIK RTPDVLGRAH PLTKSEKALA LQRANAFESE YPYFLVAIQP VYIHRGYLHL  120
PSEFARRHLV KRRARNIILK ILDGRTWLVE FKYETSVARF QRAWLAFARD NNLKVGDVCV  180
FVLIDCNERL FDVFFYHTNN AEDCPMSPVH GGGAID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-147719922143B3 domain-containing transcription factor VRN
4i1k_B1e-147719922143B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008244815.11e-163PREDICTED: B3 domain-containing protein REM19-like
RefseqXP_008244816.11e-163PREDICTED: B3 domain-containing protein REM19-like
TrEMBLM5WCL71e-96M5WCL7_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14896412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.12e-17related to vernalization1 1